PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00028034-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 66aa    MW: 7502.45 Da    PI: 10.0321
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00028034-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.62.9e-131862146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        +g+W++eEde l ++v+  G ++W+ I + +  g ++k+c++rw +
  WALNUT_00028034-RA 18 KGPWSPEEDEMLRKLVQSQGARSWSVINKAIA-GWSGKSCRLRWGN 62
                        79******************************.***********65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1171366IPR017930Myb domain
SMARTSM007172.7E-101766IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-181766IPR009057Homeodomain-like
PfamPF002491.2E-121862IPR001005SANT/Myb domain
SuperFamilySSF466892.99E-141866IPR009057Homeodomain-like
CDDcd001674.72E-102062No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
MESRFHGYAS QRDVDPVKGP WSPEEDEMLR KLVQSQGARS WSVINKAIAG WSGKSCRLRW  60
GNQLSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004305954.11e-22PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW14e-20MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2V6S92e-22A0A0D2V6S9_G
TrEMBLA0A0K2CTC62e-22A0A0K2CTC6_SOYBN; MYB/HD-like transcription factor (Fragment)
STRINGPGSC0003DMT4000643063e-21(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.12e-22myb domain protein 70